PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000135860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 163aa    MW: 19139.9 Da    PI: 9.5818
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000135860genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.96.4e-56161441129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeel+++yL kkv + ++   ++i+evd++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+ 
  MDP0000135860  16 LPPGFRFHPTDEELITYYLLKKVLDGSFIG-RAIAEVDLNKCEPWELPDKAKMGEKEWYFFSLRDRKYPTGIRTNRATEAGYWKATGKDREIYSSk 110
                    79*************************877.88***************99999****************************************974 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + +lvg+kktLvfy+grapkgek++W+mheyrle
  MDP0000135860 111 TCALVGMKKTLVFYRGRAPKGEKSNWIMHEYRLE 144
                    5567****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-617153IPR003441NAC domain
PROSITE profilePS5100556.09216163IPR003441NAC domain
PfamPF023651.4E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MDIMNFSTHF DHDTHLPPGF RFHPTDEELI TYYLLKKVLD GSFIGRAIAE VDLNKCEPWE  60
LPDKAKMGEK EWYFFSLRDR KYPTGIRTNR ATEAGYWKAT GKDREIYSSK TCALVGMKKT  120
LVFYRGRAPK GEKSNWIMHE YRLEGKFAYH YLSRSSKVLS HSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-511614317142NO APICAL MERISTEM PROTEIN
1ut4_B2e-511614317142NO APICAL MERISTEM PROTEIN
1ut7_A2e-511614317142NO APICAL MERISTEM PROTEIN
1ut7_B2e-511614317142NO APICAL MERISTEM PROTEIN
3swm_A2e-511614320145NAC domain-containing protein 19
3swm_B2e-511614320145NAC domain-containing protein 19
3swm_C2e-511614320145NAC domain-containing protein 19
3swm_D2e-511614320145NAC domain-containing protein 19
3swp_A2e-511614320145NAC domain-containing protein 19
3swp_B2e-511614320145NAC domain-containing protein 19
3swp_C2e-511614320145NAC domain-containing protein 19
3swp_D2e-511614320145NAC domain-containing protein 19
4dul_A2e-511614317142NAC domain-containing protein 19
4dul_B2e-511614317142NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008355378.11e-115PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040177e-97NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLM5X6641e-108M5X664_PRUPE; Uncharacterized protein
STRINGVIT_19s0014g02200.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.14e-98NAC family protein